| Bioactivity | [Des-His1,Glu9]-Glucagon amide is a potent and peptide antagonist of the glucagon receptor, with a pA2 of 7.2. [Des-His1,Glu9]-Glucagon amide is potentially useful in the study of the pathogenesis of diabetes[1]. |
| Name | [Des-His1,Glu9]-Glucagon amide |
| CAS | 110084-95-2 |
| Sequence | Ser-Gln-Gly-Thr-Phe-Thr-Ser-Glu-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-NH2 |
| Shortening | SQGTFTSEYSKYLDSRRAQDFVQWLMNT-NH2 |
| Formula | C148H221N41O47S |
| Molar Mass | 3358.65 |
| Transport | Room temperature in continental US; may vary elsewhere. |
| Storage | Please store the product under the recommended conditions in the Certificate of Analysis. |